PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cagra.3373s0030.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family MYB
Protein Properties Length: 298aa    MW: 32803 Da    PI: 7.5039
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cagra.3373s0030.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.33.1e-171461148
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
      Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                         +g+WT+eEde lv  +k+ G g+W+t +++ g+ R++k+c++rw +yl
  Cagra.3373s0030.1.p 14 KGPWTPEEDEVLVAHIKKNGHGSWRTLPKEAGLLRCGKSCRLRWTNYL 61
                         79******************************99************97 PP

2Myb_DNA-binding52.98.7e-1767112148
                          TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
      Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                          rg++T+eE++l v++++ lG++ W++Ia+ ++ gRt++++k+ w+++l
  Cagra.3373s0030.1.p  67 RGPFTAEEEKLVVQLHAILGNR-WAAIAAQLP-GRTDNEIKNLWNTHL 112
                          89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.607.0E-25564IPR009057Homeodomain-like
PROSITE profilePS5129417.758961IPR017930Myb domain
SuperFamilySSF466893.41E-3011108IPR009057Homeodomain-like
SMARTSM007174.2E-131363IPR001005SANT/Myb domain
PfamPF002491.5E-141461IPR001005SANT/Myb domain
CDDcd001671.03E-101661No hitNo description
PROSITE profilePS5129425.64762116IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.4E-2665116IPR009057Homeodomain-like
SMARTSM007173.4E-1566114IPR001005SANT/Myb domain
PfamPF002492.0E-1567112IPR001005SANT/Myb domain
CDDcd001671.00E-1169112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0009909Biological Processregulation of flower development
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 298 aa     Download sequence    Send to blast
MGRTPCCDKK GLKKGPWTPE EDEVLVAHIK KNGHGSWRTL PKEAGLLRCG KSCRLRWTNY  60
LRPDIKRGPF TAEEEKLVVQ LHAILGNRWA AIAAQLPGRT DNEIKNLWNT HLKKRLLSMG  120
LDPKTHEPIT SFGLAKQAPS SPTTRHMAQW ESARVEAEAR LSRESMLFCP SSSGAGVKTD  180
CDHFLRIWNS EIGEAFRNLA PLDESATSQS PCSRTTSSSS ALQKSSTKSF GGKEVTVAIH  240
GSDSSPYSNN LEDDSTDSAL QLLLDFPISD DDMSFLEENI DSYTQTPVGV VPMVSKF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C7e-291211625128MYB TRANSFORMING PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00114ampDAPTransfer from AT3G61250Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY5196010.0AY519601.1 Arabidopsis thaliana MYB transcription factor (At3g61250) mRNA, complete cds.
GenBankBT0331290.0BT033129.1 Arabidopsis thaliana unknown protein (At3g61250) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006292176.10.0hypothetical protein CARUB_v10018382mg
TrEMBLR0H7220.0R0H722_9BRAS; Uncharacterized protein
STRINGAT3G61250.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM69822643
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G61250.10.0myb domain protein 17